Utama > Jawaban Terbaik > Cara paling sehat untuk memasak daging - solusi yang bisa diterapkan

Cara paling sehat untuk memasak daging - solusi yang bisa diterapkan

Metode memasak mana yang paling sehat?

Mengukus dan merebus

Panas lembabmetode memasak, seperti merebus dan mengukus, adalahpaling sehatcara menyiapkan daging dan produk karena dilakukan pada suhu yang lebih rendah.
8 Januari Februari 2020



Setelah Anda menjadikan sayuran sebagai bagian dari diet Anda, Anda sehat, bukan? Belum tentu. Hanya karena Anda makan sayuran secara teratur tidak berarti Anda akan mendapatkan semua nutrisi yang mereka tawarkan. Kemungkinan Anda salah memasak sayuran dan mengonsumsi sedikit atau tanpa vitamin dan serat.

manfaat sayuran silangan

Halo pemirsa dan selamat datang kembali di Bestie! Selain memengaruhi nilai gizi, cara Anda memasak sayuran juga dapat memengaruhi rasanya - dan bukan secara positif. Jika Anda ingin mendapatkan nilai gizi terbaik untuk kalori Anda, itu akan Membuat dan memasak sayuran Anda dapat membuat perbedaan besar, dan dalam artikel hari ini kami akan menunjukkan kesalahan yang harus dihindari jika Anda tidak memasaknya sama sekali. , masak terlalu banyak, masak saat basah, tambahkan bumbu, panci terlalu penuh, dan masih banyak lagi, tonton sampai habis untuk mengetahui semuanya. Meminyaki Sayuran: Mencekik sayuran Anda dengan minyak sebelum Anda mulai memasak sepertinya cara yang sangat mudah untuk menghindarinya menempel di wajan; sayangnya, menambahkan minyak meningkatkan kemungkinan sayuran hangus karena minyak menjadi sangat panas; sebagai gantinya, tambahkan lapisan tipis minyak zaitun extra virgin ke dalam wajan, lalu tambahkan sayuran.

Anda tidak perlu khawatir tentang segala sesuatu yang menempel di wajan atau sayuran gosong yang kasar. Sayuran apa yang ingin Anda sertakan dalam menu harian Anda? Mana yang pasti kamu hindari? Kami ingin tahu di komentar di bawah! Jangan memasak sama sekali: Banyak sayuran lebih sehat saat mentah, tetapi tidak semuanya. Bit, brokoli, bawang, dan paprika memiliki lebih banyak nutrisi mentah, tetapi yang lain sebenarnya menjadi lebih bergizi saat dipanaskan.



Asparagus memiliki sifat melawan kanker yang diaktifkan saat dikukus. Jamur memberi Anda lebih banyak potasium saat ditumis, dipanggang, atau dipanggang. Selama bayam mentah terasa enak dalam salad, Anda bisa mendapatkan lebih banyak kalsium, zat besi, dan magnesium dalam esium Anda dari makanan yang dimasak.

Juga untuk tomat - Anda mendapatkan lebih banyak likopen penangkal kanker saat dimasak, jadi sebaiknya makan banyak sayuran mentah, meskipun juga beberapa dimasak dengan resep yang luar biasa. Menyiapkan Sayuran Terlalu Dini: Beberapa orang suka bergerak maju dan melakukan tugas di depan waktu dan bukan pada menit terakhir. Meskipun ini adalah kualitas yang baik untuk beberapa hal, itu tidak selalu berhasil untuk sayuran.

Jika Anda mencuci dan memotongnya, oksidasi dan kehilangan nutrisi akan dimulai, seperti halnya layu dan pembusukan. Lebih baik potong sayuran Anda tepat sebelum menggunakannya. Jika Anda perlu menggilingnya terlebih dahulu, jangan lakukan lebih awal dari pagi atau malam sebelumnya.



Hal yang sama berlaku untuk mencuci dan menyiapkan sayuran. Segera setelah Anda mencuci sayuran, mereka mulai layu, jadi jangan mencucinya sampai Anda menggunakannya. Jika Anda hanya perlu mencucinya terlebih dahulu, masukkan ke dalam tas dengan handuk kertas di sekelilingnya untuk menyerap kelembapan berlebih.

Terlalu banyak merebus: Memasak bisa menjadi cara cepat untuk menyiapkan sayuran Anda, tetapi juga cara cepat untuk menghilangkan bahan dan rasa dalam waktu singkat. Saat memasak, nutrisi yang larut dalam air dari sayuran meresap ke dalam air rebusan. Perebusan juga dapat menyebabkan perebusan berlebihan, membuatnya lunak, abu-abu dan lembek.

Sayuran hanya boleh mengapung di air mendidih saat membuat sup dan acara, hanya untuk waktu yang singkat. Jika Anda merebusnya dalam air mendidih untuk melunakkannya, lakukan hanya selama beberapa menit dan rendam dalam penangas es sebelum kehilangan warna cerahnya. Gunakan metode lain untuk memasak sayuran seperti mengukus, menumis, menumis, atau memanggang.



Sayuran tidak hanya terkena panas untuk waktu yang lebih singkat, tetapi juga menawarkan banyak pilihan untuk menambahkan rasa dan bumbu. Melebihi Panci: Terkadang saat Anda sedang terburu-buru, Anda bisa memasukkan terlalu banyak sayuran ke dalam wajan untuk dimasak. Jika Anda mengisi panci terlalu penuh, alih-alih menjadi karamel, makanan akan mengukus, menumis, atau menjadi renyah.

Juga, jika Anda memasukkan makanan ke dalam minyak, suhu minyak akan turun, sehingga tidak matang pada suhu optimal. Jika Anda memasukkan seluruh buncis ke dalam wajan atau wajan sekaligus, mereka akan menjadi lembek. Taruh sebanyak itu Sayuran dalam satu lapisan mungkin dengan beberapa ruang di sekitar potongan; ketika Anda memiliki lebih banyak sayuran untuk dimasak, lakukan dalam beberapa kelompok atau gunakan wajan atau wajan terbesar yang Anda miliki.

Mengasapi Sayuran: Meskipun Anda menyukai rasa yang sedikit gosong yang diberikan panggangan Anda pada tusuk sate sayuran, lingkungan yang panas dan kering dapat menghabiskan nutrisi produk Anda. Yang lebih buruk, jika Anda membiarkannya di atas panggangan cukup lama sehingga terlihat menghitam dan hangus, itu adalah tanda bahwa sayuran telah terpapar benzopyrene, bahan kimia penyebab kanker yang ditemukan dalam asap rokok. lewati kebab dan masak sayuran Anda di keranjang panggangan.

Taktik ini menghilangkan risiko memakan arang berbahaya dan membantu sayuran mempertahankan kelembapan, vitamin, dan mineralnya. Gunakan api sedang hingga tinggi dan lewati gerimis minyak zaitun sebelum memanaskan sayuran Anda. Dengan merebusnya hingga kering dan menambahkan lemak setelahnya, Anda dapat mengurangi asap yang mengonsumsi antioksidan.

Mereka membuang bagian yang baik: seberapa sering Anda memiliki tangkai dan daun brokoli dan membuangnya ke tempat sampah? Atau mentimun dan kulit kentang yang sudah dikupas? Jangan malu jika Anda sering melakukannya - itu adalah kesalahan umum. Tapi sekarang saatnya untuk mengubah kebiasaan Anda dan berhenti makan bagian yang paling sehat dari sayuran. Kulit, daun, dan batangnya mengandung nutrisi unik yang tidak ditemukan di bagian lain dari sayuran.

Mereka juga memiliki konsentrasi vitamin yang lebih tinggi daripada bagian yang lebih umum. Jauhkan dari pengupas dan dinginkan dengan Chop-n-Toss. Gunakan batang dan daun brokoli dalam tumisan, sup, dan salad untuk mendapatkan nutrisi yang meningkatkan kesehatan. Mereka memanggang pada suhu yang terlalu rendah: Sayuran yang dipanggang dengan sempurna memiliki kekuatan untuk mengubah bahkan pembenci terbesar menjadi penggemar nomor satu.

Tetapi jika yang Anda keluarkan dari oven tidak berwarna cokelat dan renyah di luar, lembut dan lembut di dalam, i Ada yang tidak beres dan mungkin suhu memasaknya. 400-450 derajat adalah titik manis untuk sebagian besar sayuran untuk mendapatkan bagian luar karamel yang lezat dan pada saat yang sama memastikan bagian dalamnya matang. Tidak hanya suhu oven yang optimal yang harus dipertimbangkan saat memanggang sayuran, wajan yang benar juga harus . Nampan pemanggang adalah wajan yang sempurna untuk menggoreng sayuran karena sisinya yang rendah.

Apa pun yang terlalu tinggi akan mencegah air menguap, yang dapat menyebabkan sayuran lembek. Memasak sayuran saat basah: Anda mungkin tidak menyadari bahwa Anda melakukan kesalahan umum ini. Mencuci sayuran memang bagus, tetapi tidak mengeringkannya sebelum dimasak dapat merusak hidangan yang terlalu basah.

Jika terlalu basah, air akan menghasilkan uap yang akan menghasilkan makanan lembek. Pengeringan yang menyeluruh akan membuat sayuran Anda tetap ringan dan renyah. Makanan basah juga bisa berbahaya jika diletakkan di wajan panas dengan minyak.

Sebelum memasak sayuran Anda, letakkan di atas handuk teh bersih atau handuk kertas dan keringkan hingga kering. Ini akan membantu Anda mendapatkan hasil maksimal dari makanan Anda dan sepadan dengan waktu ekstra. Memasak dengan cara yang sama setiap saat: Saat kita lapar, cara termudah adalah memasak makanan seperti yang kita ketahui.

Itu baik-baik saja untuk sementara waktu, tetapi kemudian menjadi membosankan. Sayuran bisa dimasak dengan banyak cara. Ini juga akan membantu anak-anak yang tidak terlalu suka sayuran, memutuskan cara terbaik untuk memasak produk mereka, dan membiasakan diri dengan menu yang bervariasi.

Bumbu sayuran: Setiap sayuran memiliki rasa yang unik. Tapi itu tidak berarti Anda tidak boleh menambahkan lebih banyak. Garam dan merica memang enak, tapi itu tidak cukup.

Sayuran dapat direndam dalam kombinasi aromatik tamari, asam amino cair, kaldu, cuka, dan rempah-rempah. Mereka dapat dilemparkan ke dalam campuran bumbu dan rempah-rempah favorit Anda. Dengan mengubah profil rasa bumbu, Anda dapat mengambil sayuran seperti bayam dan memasaknya dengan berbagai cara dan setiap hidangan akan terasa unik dan fantastis.

Tidak Dicuci dengan Benar Sebelum Dimasak: Sayuran yang ditanam secara konvensional, sarat pestisida seperti seledri, bayam, paprika manis, dan tomat semuanya ditampilkan dalam daftar Dirty Dozen tahunan kelompok kerja lingkungan, jika Anda segera membilas sayuran ini atau tidak mencuci sama sekali, Anda Kemungkinan menggunakan residu kimia yang dapat menyebabkan sakit perut, mual, dan diare. Yang terburuk, bahan kimia ini tidak datang dan pergi begitu saja. Mereka bersembunyi di sel lemak Anda sampai Anda melakukan diet dan mulai menurunkan berat badan.

Menurut peneliti, bahan kimia keluar dari hibernasi dan masuk ke aliran darah saat berat badan turun, memperlambat penggunaan energi dan metabolisme. Bahkan jika Anda selalu membeli sayuran organik, rendam sayuran Anda dalam panci berisi air selama 10-15 menit sebelum memakannya. Kemudian bilas lagi sebentar di bawah air mengalir untuk memastikan sudah bersih.

Sekarang Anda menyadari kesalahan yang Anda buat saat memasak dengan sayuran, mengetahui mana yang terbaik untuk kesehatan Anda adalah penting karena tidak semua sayuran diciptakan sama. Dapatkan Jawaban Anda Di Sini: Pelajari Tentang 9 Makanan Paling Bergizi Di Planet ATAU Pelajari Tentang 8 Sayuran Sehat yang Harus Anda Makan Dan 8 yang Tidak Boleh Dikonsumsi 2 artikel ini pasti akan membantu Anda menemukan sayuran yang baik untuk Anda Dia adalah yang paling sehat . Juga, jangan lupa untuk menyukai dan berlangganan saluran kami.

Berapa banyak dari kesalahan ini yang sering Anda lakukan? kita tahu di komentar di bawah!

Metode memasak mana yang terbaik untuk mempertahankan nutrisi?

Mengukus adalah salah satumetode memasak terbaikuntuk melestarikannutrisi, termasuk vitamin yang larut dalam air, yang sensitif terhadap panas dan air (4 , 5, 6, 17 ). Para peneliti telah menemukan bahwa mengukus brokoli, bayam, dan selada mengurangi kandungan vitamin C mereka hanya 9-15% (5).24 Januari 2017 November

Saat ini semuanya berputar di sekitar makan sehat. Mana yang lebih banyak nutrisinya? Apakah ini kangkung bebas? Apakah Mentega itu Karbohidrat? Hari ini kami akan membantu Anda dan memberi tahu Anda cara mendapatkan nutrisi paling banyak dari sayuran Anda. Sayuran sangat bagus untuk Anda yang penuh dengan vitamin esensial yang kita butuhkan, tetapi tubuh kita tidak dapat membuatnya sendiri.

Nutrisi ini membantu Anda berfungsi, tumbuh, dan melawan penyakit. Biarkan saya memberi Anda ringkasan singkat tentang vitamin. Vitamin yang larut dalam air memiliki sifat antioksidan yang membantu dalam perbaikan jaringan dan mengurangi risiko penyakit kardiovaskular.

Vitamin yang larut dalam lemak sangat bagus untuk mata, hati, darah, dan tulang. Sayuran juga merupakan sumber mineral yang mengatur proses penting dalam tubuh. Magnesium membuat otot, saraf, darah, dan tulang kuat dan sehat.

Zat besi sangat penting untuk pertumbuhan dan pembentukan hemoglobin, protein yang membawa oksigen ke seluruh tubuh Anda. Kau mengerti. Nutrisi baik untuk Anda.

Sekarang Anda akan belajar bagaimana membuat sebagian besar sayuran Anda yaitu. Anda mungkin pernah mendengar bahwa produk segar lebih baik untuk Anda, tetapi itu mungkin tidak selalu benar. Jika yang Anda idamkan di luar musim, cobalah produk beku kilat.

Dalam sebuah penelitian, para ilmuwan menemukan sayuran beku Kacang hanya kehilangan seperempat vitamin C setelah setahun! Dibandingkan dengan kacang hijau dingin, yang kehilangan tiga perempat vitamin C mereka hanya dalam seminggu. Memasak bisa menjadi cara yang bagus untuk mendapatkan semua nutrisi lezat ini dari sayuran Anda. Panas menghancurkan dinding sel tanaman, melepaskan vitamin dan mineral untuk penyerapan yang lebih mudah, tetapi ada kekurangannya.

Penyebab besar di balik hilangnya nutrisi adalah air rebusan Anda. Ini mengeluarkan serat dan vitamin yang larut dalam air, meninggalkan Anda dengan air yang kaya nutrisi sementara sayuran Anda tidak sesehat yang seharusnya. Para peneliti menemukan bahwa brokoli yang dimasak kehilangan sekitar 35% vitamin C-nya, sementara mengukus menyebabkan kehilangan sekitar 20% dan memasak dengan microwave dan tekanan hanya menyebabkan kehilangan 10%.

Namun, hilang bukan berarti musnah seperti yang Anda konsumsi. Dengan cairan masak ini, misalnya dalam sup atau saus yang lezat, Anda bisa mendapatkan kembali semua nutrisi ini. Anda dapat meminimalkan pencucian dengan menggunakan lebih sedikit air dan memotong sayuran menjadi potongan besar untuk permukaan yang tidak terlalu terbuka.

Panas dan minyak juga buruk bagi nutrisi. Vitamin dipecah dengan waktu pemanasan yang lebih lama, sementara mineral menahan panas lebih baik - sesuatu yang perlu dipertimbangkan saat memilih antara pemanggangan cepat atau pemanggangan lama. Menggoreng adalah pilihan yang paling tidak sehat.

Mengejutkan saya tahu Minyak goreng tidak hanya menghilangkan vitaminit yang larut dalam lemak dapat dipanaskan hingga suhu yang jauh lebih panas sehingga banyak senyawa tidak dapat bertahan. Dan Anda tahu itu digoreng. Jadi kelezatan ini ada harganya: dalam hal ini, asam lemak jenuh dan, tergantung bagaimana cara menggorengnya, lemak trans.

Di sinilah kimia benar-benar dapat membantu Anda. Prinsip kimia dari suka larut berarti Anda memiliki vitamin yang larut dalam air dalam air dan yang larut dalam lemak Anda kehilangan vitamin dalam minyak goreng. TAPI ini juga dapat digunakan untuk keuntungan Anda.

Makan makanan dengan vitamin yang larut dalam lemak bersama dengan sedikit lemak baik dapat membantu tubuh Anda menyerap nutrisi. Satu studi menemukan bahwa makan selada bersama dengan alpukat atau saus berbasis minyak membantu peserta mendapatkan jauh lebih banyak karotenoid sehat daripada selada biasa. Karena jika Anda menggiling salad dengan gigi Anda, saus berminyak akan sangat senang menyerap lemak yang larut. vitamin - ingat cara melarutkannya.

Itu membuat vitamin-vitamin itu lebih mudah mengirimkan nutrisi ke tubuh Anda, mengapa tidak memakannya mentah saja, bukan? Nah, ada alasan untuk membiarkan makanan tetap utuh, misalnya kulit wortel dan kentang yang kaya akan serat. Tapi itu tidak sesederhana itu. Sebuah studi tahun 2008 menemukan bahwa orang-orang yang menjalani diet mentah memiliki kadar beta-karoten yang lebih tinggi dari biasanya, antioksidan yang mengubah wortel menjadi oranye dan membantu menjaga kesehatan kulit dan penglihatan.

TAPI mereka memiliki tingkat likopen yang jauh lebih rendah, antioksidan yang membuat tomat menjadi warna khas mereka, dan telah dikaitkan dengan penurunan risiko kanker dan penyakit jantung. Itu karena memasak dengan minyak mengubah likopen menjadi struktur yang lebih melengkung yang lebih mudah diserap tubuh Anda. Dengan kata lain, memasak memberi Anda akses lebih mudah ke nutrisi penting tertentu.

Jadi, lain kali Anda memasak dan tidak memesan makanan untuk dibawa pulang, gunakan tips ini untuk mendapatkan nutrisi paling banyak dari produk Anda bersama dengan rasa. Ingatlah bahwa setiap sayuran seperti kepingan salju yang unik dan mereka mempertahankan nutrisinya dengan cara yang berbeda tergantung cara Anda memasaknya. Apa sayuran favorit Anda dan bagaimana Anda menyiapkannya? Saya suka bayam kami, idealnya ditumis dan direndam dalam minyak zaitun, Parmesan dan bawang putih, bawang putih dan lebih banyak bawang putih.

Bawang putih tidak pernah cukup, tinggalkan kami favorit Anda di komentar dan terima kasih telah menonton.

Apa cara terbaik untuk memasak daging?

Panas Kering- Panas keringmetodedarimemasakcocok untuk potongan tenderdagingatau kurang lembut potongan yang telah diasinkan. Panas keringmetodetermasuk memanggang, memanggang oven, memanggang, memanggang, menggoreng dan mengaduk-menggoreng. Memanggang—inimetodedarimemasakdirekomendasikan untuk potongan yang lebih besar daridaging sapi, sapi, babi dan domba.

apakah minyak sayur buruk untuk Anda?

Hari ini di The Stay at Home Chef, saya akan menunjukkan cara memasak steak dengan sempurna setiap saat. Metode ini bekerja untuk steak apa pun dan akan membantu Anda mendapatkan steak yang sempurna setiap saat dengan sederhana dan saya akan menunjukkan cara melakukannya, hal pertama yang perlu Anda lakukan adalah mengeluarkan steak Anda dan membiarkannya pada suhu kamar setidaknya selama 30 menit. Jika Anda menggunakan steik beku, Anda harus mencairkannya di lemari es terlebih dahulu, tetapi Anda menginginkannya dalam suhu ruangan.

Jika Anda perhatikan kami menggunakan steak tebal yang enak. Steak tebal sebenarnya lebih mudah dimasak dengan sempurna. Steak tipis dimasak terlalu cepat dan bahkan bisa mengering, jadi pilihlah steak tebal yang enak.

Hari ini kami menggunakan beberapa steak strip New York, tetapi metode yang sama bekerja dengan ribeye atau T-bone atau bahkan fillet jadi pilihlah steak yang Anda suka dapat melihat bahwa steak ini memiliki marmer yang bagus dan sedikit lemak di bagian luar. Sebenarnya ada 3 eef B-Grade yang berbeda: Select, Choice dan Prime, dan semuanya didasarkan pada marmer dan rasa daging sapi. Sekarang perbedaan antara Select dan Choice cukup besar, jadi saya selalu menyarankan untuk memilih setidaknya Choice atau Prime Grade beef saat Anda membuat steak..Ini sebenarnya adalah steak kelas atas New York. Begitu steak Anda mendapat kesempatan Harus duduk pada suhu kamar selama 30 menit, panaskan oven Anda hingga 375 derajat Fahrenheit dan panaskan wajan besar yang berat di atas kompor sampai berasap. Kami sedang menyiapkan steak kami.

Gerimis setiap steak dengan sedikit minyak zaitun dan di atas, di samping serta gosok di bawah. Kemudian kita akan menyatukan gosok kita. Hari ini saya akan membuatnya sangat sederhana dan hanya menggunakan campuran garam dan merica.

Saya akan menggunakan 1 sendok teh garam, 1/2 sendok teh lada hitam dan 1/2 sendok teh lada putih dan mencampurnya bersama-sama dapat menambahkan rempah-rempah dan rempah-rempah lainnya, tetapi saya hanya menyukainya dan membiarkan dagingnya bersinar. Kami mengambil campuran ini dan menaburkannya ke seluruh steak kami dan menggosoknya secara langsung dan Anda ingin memastikan Anda melakukan kedua sisi. Sekarang steak ini benar-benar tebal, Anda ingin menjadi sedikit lebih berat dari yang Anda kira.

Sebelum kita memasak steak kita Hal terakhir yang ingin kita lakukan adalah melakukan sesuatu. Saya suka menambahkan mentega ke steak saya, jadi saya membuat mentega bawang putih dengan menggunakan garpu untuk mencampur 2 sendok makan mentega lunak dengan 1-2 siung bawang putih yang dihancurkan. Anda juga bisa menambahkan rempah segar ke mentega ini untuk membuat mentega rempah, tapi saya akan membuatnya sederhana dengan sedikit bawang putih.

Selanjutnya kami pergi ke kompor dan saya cukup yakin panci kami berasap panas, itulah yang kami butuhkan. Tempatkan steak langsung di wajan. Anda tidak perlu menambahkan minyak atau apa pun, dan kami akan membakar setiap sisi steak selama 2-3 menit per sisi.

Dan karena ini memiliki sedikit lemak mengalir di samping, Anda tidak ingin lemak turun, cukup balikkan ke samping dan tahan di sana dengan tang. Anda selalu ingin menghabiskan lemak sehingga Anda tidak berakhir dengan sepotong lemak tebal di tepinya. Setelah dipanggang di kedua sisi dan lemaknya sudah matang, masukkan saja ke dalam oven untuk menyelesaikan memasak.

Waktu yang dibutuhkan untuk meninggalkan steik Anda di dalam oven tergantung pada berapa lama Anda telah membakar steik Anda dan seberapa tebalnya. Aturan praktis yang baik adalah sekitar 5 menit per inci, tetapi jika Anda menginginkan hasil yang 100% akurat, gunakan termometer daging. Saya mengeluarkan steak saya ketika mencapai 130 derajat Fahrenheit untuk medium rare yang bagus.

Steak harus didiamkan setidaknya 10 menit sebelum disajikan, jadi Anda harus mengoleskan satu sendok makan mentega ke masing-masing agar meleleh di atas steak saat beristirahat. Saat Anda membiarkan steik Anda beristirahat, suhu internal akan terus meningkat sekitar 5 derajat. Penting untuk membiarkan steak Anda beristirahat karena memberi mereka kesempatan bahwa jus akan diserap kembali ke dalam daging, memberi Anda steak yang paling juicy dan paling sempurna.

Setelah 10 menit istirahat Anda siap untuk makan! Terima kasih Untuk resep lengkapnya, lihat deskripsi artikel. Berlangganan, Suka, dan ikuti artikel saya lainnya, di mana Anda dapat menemukan ratusan resep berkualitas restoran yang dapat Anda buat dengan mudah di rumah. Sampai jumpa lagi!

Daging apa yang paling sehat untuk dimakan?

5Daging Tersehat
  1. Kerbau (Bison) Tidak peduli seberapa bagus putihnyadagingbisa jadi, itu tidak akan pernah benar-benar memuaskan keinginan untuk merahdaging.
  2. Babi. Daging babi dulu ada di daftar sasaran dokter.
  3. Ayam. putihdagingjauh lebih baik untuk Anda daripada merah — itu fakta yang terkenal.
  4. Turki. Burung besar ini tidak pernah melihatnya datang.
  5. Ikan.
9 Oktober 2009

Dalam artikel hari ini, kita akan berbicara tentang empat jenis daging paling sehat yang bisa Anda makan. Daging telah dibenci, dan salah, dalam beberapa dekade terakhir, sehingga hubungan antara daging, yang menyebabkan penyakit seperti penyakit jantung dan kanker usus besar, paling lemah, tetapi itu masih cukup untuk membuat sebagian besar dari kita berpaling dari daging dan daging merah. Negara-negara Barat khususnya makan lebih sedikit daging daripada sebelumnya, tetapi entah bagaimana penyakit yang disebabkan oleh daging semakin meningkat. Yang benar adalah bahwa daging sangat bergizi dan baik untuk kesehatan kita, mengandung beberapa vitamin dan mineral yang tidak bisa kita dapatkan cukup dari tumbuh-tumbuhan saja, yang menjadikannya bagian penting dari makanan kita, tetapi kenyataannya, beberapa daging lebih sehat daripada daging lainnya, jadi di artikel hari ini kita akan membahas empat jenis daging tersehat yang bisa kalian lakukan hai semua selamat datang kembali di channel saya jika kalian baru di sini nama saya kait saya seorang pelatih kesehatan dan saya posting artikel tentang diet padat nutrisi tinggi lemak jika Anda l saya suka artikel ini, tolong beri jempol jangan ragu untuk berbagi dan berlangganan dan ikuti saya di Instagram, Twitter dan Facebook di mana saya berbagi posting baru setiap hari seperti yang saya katakan di awal artikel ini bahwa daging salah selama beberapa dekade setan.

Salah satu alasan aslinya adalah karena mengandung kolesterol, dan diperkirakan bahwa diet kolesterol ini akan meningkatkan kadar kolesterol darah kita dan menyebabkan penyakit jantung. Ternyata kolesterol makanan memiliki sedikit efek pada kadar kolesterol darah kita, menghasilkan lebih dari 70% kolesterol dalam darah kita dan menyesuaikan persentase itu dengan jumlah yang kita konsumsi dari makanan. Ketika kita menelan lebih banyak kolesterol dari makanan, tubuh kita memproduksi lebih sedikit, dan ketika kita menelan lebih banyak kolesterol dari makanan, tubuh kita menghasilkan lebih banyak kadar darah ketika kolesterol makanan meningkat atau menurun, bahkan menurut Pedoman Diet AS, dia menghentikan rekomendasi pembatasan diet pada kolesterol. pada tahun 2015.

Jika Anda ingin tahu lebih banyak tentang kolesterol dan perannya dalam kesehatan kita, saya mengunggah artikel tentang masalah ini minggu lalu yang akan memberikan kejelasan lebih lanjut. Alasan utama lainnya daging dianggap tidak sehat adalah karena mengandung lemak jenuh, tetapi lemak diet yang kita konsumsi tidak berarti lemak dalam darah kita yang disalahkan. Ada semakin banyak bukti bahwa lemak jenuh bukanlah penyebab penyakit, tetapi sebenarnya bermanfaat bagi kesehatan kita.

Daging juga merupakan sumber protein yang unggul jika dibandingkan. Jika Anda menanam sumber protein seperti kacang-kacangan dan polong-polongan, Anda tidak hanya bisa mendapatkan lebih banyak protein dengan kalori lebih sedikit, tetapi protein itu sendiri lebih tersedia secara hayati, selain vitamin dan mineral dalam daging. lebih tersedia secara hayati juga. Ambil vitamin A misalnya, sementara berbagai versi nutrisi ini sering disatukan.

Mereka sebenarnya sangat berbeda dari beta karoten, yang merupakan bentuk vitamin A yang ditemukan pada tumbuhan yang diubah menjadi retinol untuk digunakan tubuh. Kecepatan di mana kita dapat melakukan konversi ini sangat lambat. Lebih dari setengah populasi memiliki mutasi gen yang secara signifikan menurunkan regulasi konversi ini.

Retinol adalah bentuk vitamin A yang hanya ditemukan dalam makanan hewani dan karena sudah diubah sebelumnya, kita dapat menelan dan menggunakannya lebih banyak, tetapi mari kita membahas empat daging tersehat yang dapat Anda makan dan tetap melaluinya Tetap di akhir karena saya berpikir nomor satu mungkin akan mengejutkan Anda empat daging sapi mari kita mulai dengan daging sapi seperti yang saya sebutkan sebelumnya bahwa daging sapi secara khusus telah disalahartikan selama beberapa dekade - kami diberitahu untuk menguranginya demi daging yang lebih ramping seperti ayam, Tetapi kenyataannya adalah bahwa daging sapi adalah satu dari jenis daging terbaik untuk dimakan, ada sembilan asam amino esensial yang kita semua perlu konsumsi setiap hari untuk kesehatan yang optimal. Daging sapi dan semua jenis protein hewani lainnya dianggap sebagai sumber protein lengkap karena mengandung sembilan asam amino esensial dalam jumlah seimbang. Protein nabati dianggap tidak lengkap dan perlu digabungkan bersama untuk mendapatkan semua asam amino esensial dalam jumlah yang tepat, jumlah protein yang bisa Anda dapatkan dalam steak empat ons, itu hanya 180 kalori, tetapi protein bukan satu-satunya alasan. Mengapa Daging Sapi Itu Hebat Sapi adalah hewan ruminansia, yang berarti mereka memiliki sistem pencernaan yang dirancang untuk mengekstrak nutrisi dari tanaman.

Makanan difermentasi dalam perut khusus sebelum pencernaan seperti manusia, jika kita memakan tanaman yang sama dengan yang dimakan sapi, kita mungkin tidak mendapatkan nilai nutrisi yang sama karena sistem pencernaan kita tidak dirancang untuk melakukannya, tapi inilah hal kerennya tentang semua nutrisi Sapi keluar dari sistem pencernaannya yang kompleks diturunkan kepada kita saat kita makan daging mereka sekarang, dalam hal apakah Anda perlu makan 100 daging sapi yang diberi makan rumput r ini adalah topik yang banyak diperdebatkan dalam hal nilai gizi , mereka sangat mirip daging sapi yang diberi makan rumput sedikit lebih bergizi tetapi perbedaannya cukup kecil, ada alasan lain untuk memilih daging sapi yang diberi makan rumput dan saya pribadi mencoba untuk mendapatkan 100 daging sapi yang diberi makan rumput kapan pun saya bisa, tetapi kenyataannya adalah bahwa sebagian besar sapi Menghabiskan sebagian besar hidup mereka di padang rumput, dengan satu atau lain cara jika anggaran Anda adalah 100 sapi yang diberi makan rumput. Tentu saja, pilihlah bahwa ada beberapa opsi yang sangat terjangkau yang muncul dan kunjungi situs web eatwild.org ketika berada di Amerika Utara yang menghubungkan Anda dengan pertanian lokal.

Ada juga toko daging dan penduduk setempat jika Anda berada di AS atau Kanada. Daging yang dibesarkan, tetapi jika anggaran Anda tidak diberi makan rumput, jangan merasa bersalah membeli daging Oregon konvensional # 3. Ini adalah kategori yang sedikit lebih luas daripada jenis daging tertentu, tetapi saya harus memasukkan jeroan dalam daftar ini.

Daging organ, dan hati hewan khususnya, sangat bergizi. Mereka adalah makanan paling bergizi di pasaran dalam hal vitamin dan mineral yang tersedia secara hayati. Hati sapi sebagian besar mengeluarkan segala sesuatu yang lain dari air, tetapi ginjal, limpa jantung, dan organ lain juga bagus sekarang.

Alasan saya tidak memasukkan jeroan nomor satu dalam daftar ini adalah karena Anda hanya mengkonsumsinya dalam jumlah kecil perlu memanfaatkannya. Satu hingga dua porsi kecil hati seminggu akan membantu memaksimalkan diet Anda. Tidak suka rasa hati, Anda bisa menggilingnya dan mencampurnya dengan daging giling.

Buat roti burger dan ini adalah cara mudah untuk menyembunyikannya di makanan Anda dan bahkan tidak menyadarinya. Pilihan lainnya adalah minum kapsul hati sapi untuk menyebutkan opsi ini karena saya selalu ditanya kapan orang ingin makan hati untuk nilai gizinya tetapi tidak tahan dengan rasanya, jika mereka minum enam kapsul hati sapi sehari setara sekitar satu Makan hingga dua porsi hati sapi seminggu Merek yang saya gunakan selama beberapa tahun terakhir adalah nutrisi padang rumput dan saya sangat menyukainya karena semuanya bersumber dari Australia dari daging sapi terbaik dan mereka adalah keluarga kecil usaha milik pensiunan petani. Mereka mulai membuat produk ini karena mereka merasakan sendiri manfaat hati sapi dan ingin membuatnya lebih mudah diakses, tetapi ya, jika Anda ingin mencobanya, saya akan menautkan produk di kotak deskripsi di bawah dengan kode turun sepuluh persen Untuk menyimpan salmon nomor dua untuk beberapa alasan, ikan sering tidak dianggap daging, yang menurut saya aneh, tetapi hari ini kita menganggapnya sebagai daging.

Salmon adalah ikan air dingin yang berlemak dan jenis ikan ini adalah salah satu sumber omega-3 terkaya dan penting untuk dicatat bahwa bentuk omega-3 yang ditemukan pada ikan adalah bentuk terbaik yang dapat Anda konsumsi, jenis omega-3 ditemukan dalam kacang-kacangan dan biji-bijian Prekursor nutrisi akhir Ketika Anda mendapatkannya dalam bentuk konsumsi, tubuh Anda harus mengubahnya, dan proses konversi ini sangat buruk. Jenis asam lemak omega-3 yang ditemukan pada ikan seperti salmon sudah diubah sehingga Anda dapat menggunakannya lebih banyak dan omega-3 sangat penting untuk kesehatan otak, kesehatan jantung, dan juga kesehatan sendi kita seperti yang telah disebutkan sebelumnya, pada daging sapi. , perbedaan nutrisi antara rumput dan konvensional tidak terlalu besar, tetapi ketika menyangkut salmon, perbedaan antara tangkapan liar dan pemeliharaan lebih penting, jadi dalam hal ini saya akan mendorong Anda untuk menangkap ikan secara liar jika Anda sekarang dapat hidup di sebuah negara di mana tidak mudah untuk mendapatkan salmon yang ditangkap secara liar. Saya tinggal di Australia misalnya dan hampir semua salmon segar dibudidayakan sayangnya pilihan lain adalah membelinya dalam kaleng.

Anda dapat membeli salmon kalengan yang ditangkap liar di sini dan jika Anda benar-benar tidak dapat menemukannya, pilihan lain yang sebanding adalah sarden, mackerel, herring, dan ikan teri. Domba nomor satu seperti sapi Domba adalah ruminansia dengan kemampuan memfermentasi makanan mereka sebelum mencerna Domba ini sangat mirip dengan diet daging sapi. Perbedaan antara domba dan sapi adalah bahwa, di beberapa negara, domba dibesarkan hampir secara eksklusif di padang rumput, hanya dibesarkan di padang rumput dan tidak pernah di penggemukan. Lebih mudah untuk membeli domba berkualitas baik daripada daging sapi di banyak tempat, tetapi bahkan jika sudah selesai di tiang, itu masih sangat bergizi.

Daging domba juga merupakan salah satu sumber terbaik asam stearat, sejenis lemak jenuh yang dikenal karena manfaat kesehatannya. Asam stearat ditemukan dalam lemak hewan, dan lemak beberapa tumbuhan. Asam stearat telah dikaitkan dengan penurunan berat badan dalam penelitian yang dilakukan pada tikus yang dikaitkan dengan asam stearat -Ketika mereka diberi makan asam linoleat atau diet yang diperkaya asam oleat, para peneliti menemukan bahwa kelompok asam stearat mengurangi lemak visceral hingga 70 persen. Dibandingkan dengan kelompok lain, penelitian menyimpulkan bahwa asam stearat dalam makanan membantu mengurangi lemak visceral juga menyebabkan kadar gula darah dan leptin yang lebih rendah adalah empat daging tersehat saya untuk dimakan sekarang sebelum kita tutup.

Saya ingin berbicara singkat tentang babi dan ayam dan mengapa mereka tidak masuk dalam daftar, meskipun saya tidak berpikir babi dan ayam harus dihindari sepenuhnya. Ada beberapa alasan mengapa saya tidak memasukkannya. Babi dan ayam diternakkan di pabrik tidak seperti hewan lain dan sayangnya dalam kondisi yang lebih buruk daripada daging sapi, mereka sering diberi makan jagung dan kedelai, yang berbeda dari makanan alami mereka karena daging babi dan ayam ini memiliki lebih banyak omega-6 daripada yang ideal. aku s.

Terlalu banyak omega-6 dalam makanan kita menyebabkan peradangan dan sayangnya kebanyakan dari kita sudah mengonsumsi terlalu banyak, tapi ini terlalu banyak. Sumber omega-6 dalam makanan kita adalah minyak nabati yang tidak sehat karena beberapa alasan tetapi salah satunya adalah omega 6 Jadi jika Anda sudah menghilangkan semua minyak nabati dari diet Anda, itulah sebagian besar pertempuran, termasuk daging babi dan ayam dalam diet Anda. diet mungkin baik-baik saja. Tentu saja, Anda dapat membeli daging babi dan ayam di padang rumput.

Ini adalah pilihan yang lebih baik, tetapi jika kita membandingkan nilai gizi hewan-hewan ini dengan apa yang saya sebutkan sebelumnya di daftar saya, jeroan sapi, salmon dan domba, babi dan ayam, itu masih tidak bisa dibandingkan, hanya itu yang saya miliki untuk Anda. hari ini memiliki. Semoga Anda menikmati artikel ini jika Anda berpikir untuk menyukai dan berlangganan dan beri tahu saya apa daging favorit Anda di bagian komentar di bawah, jika Anda benar-benar berkomentar, saya akan lebih menghargai komentar Anda. Itu membawa artikel saya ke lebih banyak orang.

YouTube lebih merekomendasikannya. Jadi ya, jika Anda meninggalkan komentar, sangat menghargai jika Anda menyukai artikel ini, Anda juga akan menyukai artikel saya tentang Lima Makanan Paling Penting Untuk Menurunkan Berat Badan Anda dapat memeriksanya di sini jika Anda ingin mengikuti perkembangan terbaru saya unggah. Anda dapat menemukannya di sini, dan jika Anda ingin melihat program pelatihan diet keto dan karnivora saya, Anda dapat menemukannya di sini terima kasih lagi teman-teman, sampai jumpa di lain waktu bye

Mana yang lebih sehat dipanggang atau dipanggang?

Dipanggangayam dandipanggangayam memiliki nilai gizi yang sama, meskipun.memanggang, di sisi lain, menghasilkan rasa yang lebih berani dan memungkinkan lemak menetes dari daging, sehingga mengurangi jumlah kalorinya. Namun,pembakaranbisa samasehatselama Anda tidak menambahkan minyak, mentega dan lemak lainnya.23 Desember 2019

Mana yang lebih sehat memanggang atau menggoreng?

Pembakarandanmemanggangkeduanya keringmemasakmetode yang dapat Anda gunakan untuk memasaksehatmakanan. Meskipun ada manfaat daripembakaranmakanan ataumemanggangmakanan, Anda harus menghindaripenggorengan. Itu tidak berarti bahwapembakarandanmemanggangadalah satu-satunyasehatmetode sekalipun.29 November Desember 2019

Apa cara paling efektif untuk memasak daging untuk mempertahankan zat gizi mikronya?

Suhu untuk memanggang dan memanggang berkisar antara 300–425 °F (149–218 °C) danmemasakwaktu dapat bervariasi dari 30 menit hingga satu jam ataulebih, tergantung pada jenis dan potongannyadaging. Secara umum, memanggang dan memanggang adalah bentuk yang sehat darimemasakyang menghasilkan kerugian minimal vitamin C.

Apa cara terbaik untuk memasak sayuran untuk mempertahankan jumlah vitamin terbesar?

SejakSayuranjangan kontak denganmemasakair saat mengukus, lebih banyakvitaminadalahdipertahankan. Keringmetode memasakseperti memanggang, memanggang dan menggoreng jugamenahanlebih besarjumlahnutrisi daripadamendidih.13 April 2015

Bagaimana cara memasak daging sampai hancur?

Lambatmemasak dagingmembuatnyaberantakan. Anda bisa merebus, atau lambatmemasakandadagingsebelum Anda membuangnya ke dalam cabai Anda untuk mendapatkan hasil yang lebih baik. Anda mungkin tidak inginmemasakcabai Anda selamadaging. Ini akan berubah menjadi bubur.

Apa yang akan terjadi jika saya makan daging setiap hari?

Kamubisameningkatkan risiko penyakit seperti kanker tertentu dan penyakit kardiovaskular. Studi secara konsisten menghubungkan konsumsi merah dan olahan yang lebih tinggidaging untukpeningkatan risiko kanker tertentu, serta penyakit kardiovaskular.3 Maret 2020

Pertanyaan Lain Dalam Kategori Ini

Cara alami untuk melawan infeksi - cara mengatasinya

Apa antibiotik alami yang paling kuat? 1.) Minyak Oregano: Minyak oregano adalah salah satu minyak esensial antibakteri yang paling kuat karena mengandung carvacrol dan timol, dua senyawa antibakteri dan antijamur. Faktanya, penelitian menunjukkan minyak oregano efektif melawan banyak strain bakteri klinis, termasuk Escherichia coli (E.05.04.2018

Buku stiker Pannini - cara mengatasinya

Dimana saya bisa mendapatkan stiker Panini? Sekarang di setiap kios k. 20/03/2021

Camilan asin - solusi tahan lama

Apa saja camilan asin? 9 camilan sehat dan asin Zaitun. Bagi mereka yang mencoba buah zaitun sejak lama dan tidak menyukainya, buah zaitun layak dicoba lagi, terutama mengingat mengandung serat dan vitamin esensial. Mentimun dan garam laut. Biskuit. Kacang. Jagung meletus. Campuran sereal pedas DIY. Sarden dan kerupuk. Keripik kentang.

Waktu Suisse - solusi yang mungkin

Apakah Waktu Swiss GMT? Swiss menggunakan satu zona waktu, dilambangkan sebagai Waktu Eropa Tengah (CET: UTC+01:00). Swiss juga mengamati waktu musim panas, bergeser ke Waktu Musim Panas Eropa Tengah (CEST: UTC+02:00).

Panduan Pramuka - solusi praktis

Apa buku pegangan Pramuka saat ini? Buku Panduan BSA Pramuka, Edisi ke-14 Baru saja diperbarui, Buku Panduan BSA Pramuka edisi ke-14 ini masih menjadi buku panduan bagi setiap Pramuka. Ada dua versi: Buku Pegangan BSA Pramuka untuk Anak Perempuan dan Buku Pegangan BSA Pramuka untuk Anak Laki-Laki.

Pengecilan otak seiring bertambahnya usia - solusi untuk

Bisakah Anda membalikkan penyusutan otak? Tidak mungkin membalikkan atrofi otak setelah itu terjadi. Namun, mencegah kerusakan otak, terutama dengan mencegah stroke, dapat mengurangi jumlah atrofi yang Anda kembangkan dari waktu ke waktu. Beberapa peneliti menyarankan bahwa strategi gaya hidup sehat dapat meminimalkan atrofi yang biasanya terkait dengan penuaan.